biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides Phone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
 


Follow us...
 


Sign up for biosensis Product Features
Visit our newsletter archive
 
 
EGFP Aeuquorea Victoria

$227.00USD


Catalogue No. PE-002-100
Description FUNCTION: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. BIOPHYSICOCHEMICAL PROPERTIES: Excitation max (nm): 488; Emission max (nm): 509; Extinction coefficient (Cm-1M-1): 61000. SUBUNIT: Monomer. TISSUE SPECIFICITY: Photocytes. PTM: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Xaa-N and Gly-(N+2), and oxidation of Tyr-(N+1) to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen. BIOTECHNOLOGY: Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. SIMILARITY: Belongs to the GFP family.
Batch No. See product label
Unit size 100 µg
Sequence Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSK GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK MVLLEFVTAAGITLGMDELYK
Other Names Enhanced Green Fluorescent Protein
Accession EGFP protein
GFP_AEQVI
Produced in E. coli
MW ~30 kDa
Purity 92% by SDS-PAGE
Form Lyophilised
Reconstitution Reconstitute in 100 µl of sterile water. Centrifuge to remove any insoluble material.
Storage After reconstitution, aliquot and keep at -20°C for long-term storage; for short term keep at 4°C.
References 1. Chalfie, M., Tu, Y. et al (1994) Science 263, 802-805
PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

MSDS

Click to download the MSDS - Click to download the MSDS

My Ice Bucket  
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account webpay@biosensis.comYou can use secured services of paypal to send us money via our email account webpay@biosensis.comYou can use secured services of paypal to send us money via our email account webpay@biosensis.com
Click to make a payment


Official PayPal Seal