My Account Cart Contents Proceed to Checkout
 


Quick Find
 
 
Use keywords to find the product you are looking for.
Advanced Search
 
 
E-Newsletter
 
Sign up for biosensis Product Features
 
 
EGFP Aeuquorea Victoria

$190.00USD

Catalogue No.: PE-002-100
Batch No.: See product label
Unit size: 100 µg
Sequence: Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSK GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK MVLLEFVTAAGITLGMDELYK
Other Names: Enhanced Green Fluorescent Protein
Accession: EGFP protein
GFP_AEQVI
Produced in: E. coli
Description: FUNCTION: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. BIOPHYSICOCHEMICAL PROPERTIES: Excitation max (nm): 488; Emission max (nm): 509; Extinction coefficient (Cm-1M-1): 61000. SUBUNIT: Monomer. TISSUE SPECIFICITY: Photocytes. PTM: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Xaa-N and Gly-(N+2), and oxidation of Tyr-(N+1) to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen. BIOTECHNOLOGY: Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. SIMILARITY: Belongs to the GFP family.
MW: ~30 kDa
Purity: 92% by SDS-PAGE
Form: Lyophilised
Reconstitution: Reconstitute in 100 µl of sterile water. Centrifuge to remove any insoluble material.
Storage: After reconstitution, aliquot and keep at -20°C for long-term storage; for short term keep at 4°C.
References: 1. Chalfie, M., Tu, Y. et al (1994) Science 263, 802-805
PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

MSDS

Click to download the data sheet - Click to download the Material Safety Data Sheet

Reviews
My Esky  Click to visit My Esky
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
Notifications  Click to visit Notifications
 
Notify me of updates to EGFP Aeuquorea Victoria
 
 
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account webpay@biosensis.comYou can use secured services of paypal to send us money via our email account webpay@biosensis.comYou can use secured services of paypal to send us money via our email account webpay@biosensis.com
Click to make a payment


Official PayPal Seal
 
 
Reviews  Click to visit Reviews
 
Write a review on this product!