| Catalogue No.: |
GP-029-50 |
| Batch No.: |
See product label |
| Unit size: |
50 µl |
| Antigen: |
A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response. |
| Other Names: |
Agrp; Agrt; Art; Agouti-related protein; |
| Accession: |
AGRP_MOUSE |
| Description: |
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats. |
| Produced in: |
Guinea pig |
| Purity: |
Neat serum |
| Applications: |
IHC. A concentration of 1 in 2000 is recommended for IHC. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. The optimal working dilution should be determined by the end user. |
| Specificity: |
Specificity was demonstrated by immunohistochemistry. |
| Cross-reactivity: |
This antibody is known to react with sheep. Other species have not yet been tested. |
| Blast it: |
If you would like to see the shared identity between different species or other proteins, follow the link in the Accession field, select the sequence (make sure that you are selecting the sequence that you are interested in, as the sequence may be the precursor rather than the mature protein for example) and copy and paste it HERE and blast/format it. |
| Form: |
Lyophilised |
| Reconstitution: |
Reconstitute in 50 µl sterile water. Centrifuge to remove any insoluble material. |
| Storage: |
It is recommended that a thawed sample is stored at 4ºC for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20ºC or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this. |
| Expiry Date: |
12 months upon reconstitution |
| References: |
Grayson BE, Allen SE, Billes SK, Williams SM, Smith MS, Grove KL (2006). Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate.
Neurosci 143 pp. 975-986. |