biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides Phone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
 


Follow us...
 


Sign up for biosensis Product Features
Visit our newsletter archive
 
 
Mouse monoclonal antibody to NeuN/Fox3 [1B7] (1-99): IgG

$287.00USD


Catalogue No. M-377-100
Description Fox3 is one of a family of mammalian homologues of Fox-1. The Fox proteins are about 46kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on Fox3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/Fox-3 has a function in RNA splicing and is expressed heavily and specifically in neuronal nuclei and cytoplasm. Our antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. We did not use full length Fox3 as immunogen since the three mammalian Fox homologues, namely Fox1, Fox2 and Fox3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules so antibodies specific for each of the three molecules can therefore be generated.
Batch No. See product label
Unit size 100 µl
Antigen Antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli.
Sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGS EASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
Antigen Location 1-99
Antigen Length 100
Antibody Type Monoclonal
Isotype IgG2a
Clone 1B7
Other Names Feminizing locus on X; Fox-1; Fox3; NeuN;
Accession A6NFN3 FOX1C_HUMAN;
Produced in Mouse
Applications Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:500 - 1:1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity The specificity of this antibody has been confirmed by WB. Two alternate transcripts can be seen at 46 kDa and 48 kDa.
Antibody Against NeuN/Fox3
Cross-reactivity Hu, Rat, Ms, Bov, Porcine
Blast URL Click here
Form Lyophilised with 5% trehalose
Appearance White powder
Reconstitution Reconstitute in sterile distilled water. Centrifuge to remove any insoluble material.
Storage After reconstitution of lyophilised antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Expiry Date 12 months after purchase
Images (click to zoom)
Mouse monoclonal antibody to NeuN/Fox3 [1B7] (1-99): IgG Rat brain neural cultures stained with Mouse monoclonal antibody to NeuN/Fox3 [1B7] M-377-100 (red), Chicken polyclonal antibody to GFAP C-1373-50 (green) and DNA (blue). The Fox3 antibody reveals strong nuclear and distal cytoplasmic staining for NeuN/Fox3 and the complete absence of staining of astrocytes, which are staining with the GFAP antibody, and other kinds of non-neuronal cells. This antibody is therefore an excellent marker of neuronal cells. Note that the same immunogen has been used to generate a rabbit polyclonal antibody to NeuN/Fox3 - see product R-3770-100.

PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

MSDS

Click to download the MSDS - Click to download the MSDS

Offices in the USA and Australia
My Ice Bucket  
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
'
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_ID
Click to make a payment


Official PayPal Seal