biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides An Australia-US partnershipPhone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
HomeAbout BiosensisBiosensis distributorsResourcesHelp deskordering from BiosensisContact usFlyers
 


Technical Notes
 
View our tech notes
 
 
Follow us...
 
Google+ Follow us on Twitter

Find us on Facebook

Sign up for Biosensis newsletters
Visit our newsletter archive
 
 

Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum

$297.00USD


Catalogue No. GP-029-50
Description AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
Batch No. See product label
Unit size 50 µl
Antigen A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Other Names Agrp; Agrt; Art; Agouti-related protein;
Accession AGRP_MOUSE
Produced in Guinea pig
Purity Neat serum
Applications IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity Specificity was demonstrated by immunohistochemistry.
Cross-reactivity This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
Blast it If you would like to see the shared identity between different species or other proteins, follow the link in the Accession field, select the sequence (make sure that you are selecting the sequence that you are interested in, as the sequence may be the precursor rather than the mature protein for example) and copy and paste it HERE and blast/format it.
Form Lyophilised
Reconstitution Reconstitute in 50 µl sterile water. Centrifuge to remove any insoluble material.
Storage Store lyophilized antibody at 2-8ºC. It is recommended that a thawed sample is stored at 4ºC for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20ºC or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
Expiry Date 12 months upon reconstitution
References Skrapits K et al (2014) Colocalization of cocaine- and amphetamine-regulated transcript with kisspeptin and neurokinin B in the human infundibular region. PLoS One 9:(8):e103977.PMID: 25084101 Application:IH, 4% PFA, frozen sections; 1:1000, 48 hr; Cy5 Fluorescent detection with antigen recovery.

Grayson BE, Allen SE, Billes SK, Williams SM, Smith MS, Grove KL (2006). Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate. Neurosci 143 pp. 975-986.
Images (click to zoom)
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum The  4% PFA fixed, frozen cryostat section of the sheep hypothalamus was incubated in guinea pig polyclonal antibodies to the mouse AGRP protein at the dilution of 1:1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum Immunohistochemical detection of AGRP in the arcuate nucleus of rat brain using Guinea pig polyclonal antibody to mouse agouti related protein (GP-029-50) incubated at the dilution of 1:1000-2000 in PBS overnight followed by incubation with Alexa-568 goat anti-guinea pig (1:500) secondary antibody. Section is 4% PFA fixed, frozen, cyrosectioned material. In rodents nerve terminals are more often identified than whole cell bodies using GP-029-50
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum Immunohistochemical detection of agouti-related protein (AGRP) synthesizing neurons in the human infundibular nucleus using the GP-029-50 primary antibody (1:50 000), followed by its visualization with the biotinylated secondary antibody-ABC method and nickel-diaminobenzidine chromogen. Photo courtesy of Dr. Erik Hrabovszky, Hungarian Academy of Sciences, Budapest, Hungary.
Guinea pig polyclonal antibody to mouse agouti related protein, AGRP (82-131): Whole serum Immunohistochemical detection of agouti-related protein (AGRP) synthesizing neurons in the arcuate nucleus of the rat using the GP-029-50 primary antiserum (1:50 000), followed by its visualization with the biotinylated secondary antibody-ABC method and nickel-diaminobenzidine chromogen. Photo courtesy of Dr. Erik Hrabovszky, Hungarian Academy of Sciences, Budapest, Hungary.
PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

MSDS

Click to download the MSDS - Click to download the MSDS

Offices in the USA and Australia
My Ice Bucket  
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_ID
Click to make a payment


Official PayPal Seal