biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides An Australia-US partnershipPhone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
HomeAbout BiosensisBiosensis distributorsResourcesHelp deskordering from BiosensisContact usFlyers

Technical Notes
View our tech notes
Follow us...
Google+ Follow us on Twitter

Find us on Facebook

Sign up for Biosensis newsletters
Visit our newsletter archive

Mouse monoclonal antibody to human Single-minded homolog 2 [3E6] (426-525): IgG


Catalogue No. M-868-100
This product is no longer available. Please see below for our recommended alternative products.
Batch No. See product label
Unit size 100 g
Antigen Partial recombinant human Single-minded homolog 2 (amino acids 426-525) with a GST tag. Sequence of antigen (without GST tag) is ESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFG QPQGSPCEVARFFLSTLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYE
Clone [3E6]
Other Names SIM2
Accession SIM2_HUMAN
Produced in Mouse
Purity Protein G purified immunoglobulin
Applications This antibody is recommended for WB and sandwich ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity Specificity has been confirmed by WB and direct ELISA against the antigen.
Cross-reactivity Human. Other species have not been tested.
Blast it To see the shared identity between different species or other proteins, follow the link in the Accession field, select the sequence that you are interested in and copy and paste it HERE and blast/format it.
Form Lyophilised from PBS pH 7.2
Reconstitution Reconstitute in 100 l of sterile water. Centrifuge to remove any insoluble material.
Storage After reconstitution keep aliquots at -20C for higher stability or at 4C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Expiry Date 12 months after purchase
Images (click to zoom)
Mouse monoclonal antibody to human Single-minded homolog 2 [3E6] (426-525): IgG Western blot detection of GST tagged recombinant human Single-minded homolog 2. Note the GST tag alone is 26 kDa.
Mouse monoclonal antibody to human Single-minded homolog 2 [3E6] (426-525): IgG Sandwich ELISA using mouse monoclonal antibody to human Single-minded homolog 2, catalogue number M-868-100, as a capture antibody. The detection limit for recombinant GST tagged Single-minded homolog 2 is 0.03ng/ml.
PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet


Click to download the MSDS - Click to download the MSDS

Offices in the USA and Australia
My Ice Bucket  
0 items
Email This Page
Tell someone you know about this product.
We Accept PayPal
You can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_ID
Click to make a payment

Official PayPal Seal