biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides An Australia-US partnershipPhone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
HomeAbout BiosensisBiosensis distributorsResourcesHelp deskordering from BiosensisContact usFlyers
 


Technical Notes
 
View our tech notes
 
 
Follow us...
 
Google+ Follow us on Twitter

Find us on Facebook

Sign up for Biosensis newsletters
Visit our newsletter archive
 
 

Rabbit antibody to Synapsin I/SYN1: affinity purified

$327.00USD


Catalogue No. R-1829-100
Description The synapsins are a family of proteins that have long been implicated in the regulation of neurotransmitter release at synapses. Specifically, they are thought to be involved in regulating the number of synaptic vesicles available for release via exocytosis at any one time. Synapsins are present in invertebrates and vertebrates and are somewhat homologous across evaluated vertebrates. (Ref: Pfam.org)
Batch No. See product label.
Unit size 100 ug
Antigen A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I (662-705 aa, KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD) has been used as the immunogen. This sequence is identical to the related mouse and rat sequences.
Sequence KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD
Antigen Location C-terminus
Antibody Type Polyclonal
Other Names Synapsin-1; Brain protein 4.1; Synapsin I; SYN1
Accession P17600 SYN1_HUMAN
Produced in Rabbit
Purity Affinity purified
Applications Western Blot (0.1-0.5 ug/mL): tested in SHG-44 cell lysate (human malignant glioma cell line), mouse and rat brain lysates, and rat cell line. Immunohistochemistry (0.5-1.0 ug/mL): tested in human glioma tissue. Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity This antibody is specific for Synapsin I as demonstrated by western blotting.
Species Against Human
Antibody Against Synapsin I
Cross-reactivity Human, mouse, rat
Form Lyophilized
Reconstitution Spin vial briefly before opening. Reconstitute in 100 uL sterile, ultrapure water to prepare 1 mg/mL solution. Centrifuge to remove any insoluble material.
Storage Store lyophilised antibody at 2-8C. After reconstitution divide into aliquots and store at -20C for long-term storage. Store at 2-8C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Expiry Date 12 months after purchase if unopened.
Images (click to zoom)
Rabbit antibody to Synapsin I/SYN1: affinity purified Left: Western blot analysis of Synapsin I expression in rat brain extract (lane 1), mouse brain extract (lane 2), and SHG-44 whole cell lysate (lane 3). Synapsin I at 78 kD was detected using rabbit anti-Synapsin I antibody at 0.5 ug/mL. Right: Analysis of Synapsin I expression in paraffin-embedded sections of human glioma tissue by Immunohistochemistry. Primary antibody: rabbit antibody to Synapsin at 1 ug/mL. The immunohistochemical section was developed using the DAB method.

PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

MSDS

Click to download the MSDS - Click to download the MSDS

Offices in the USA and Australia
My Ice Bucket  
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_ID
Click to make a payment


Official PayPal Seal