biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides An Australia-US partnershipPhone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
HomeAbout BiosensisBiosensis distributorsResourcesHelp deskordering from BiosensisContact usFlyers
 


Technical Notes
 
View our tech notes
 
 
Follow us...
 
Google+ Follow us on Twitter

Find us on Facebook

Sign up for Biosensis newsletters
Visit our newsletter archive
 
 

Rabbit polyclonal antibody to human beta Endorphin (1-31)

$297.00USD


Catalogue No. R-1492-50
Description Human beta-endorphin is a 31 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). It is an endogenous opioid peptide neurotransmitter that interacts with opioid receptors.
Batch No. See product label
Unit size 50 ug
Antigen Synthetic human beta-endorphin peptide (1-31 aa) conjugated to BSA.
Sequence YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Antigen Location 1-31 aa
Other Names -endorphin; Pro-opiomelanocortin; POMC;
Accession P01189 COLI_HUMAN;
Produced in Rabbit
Applications A dilution of 5-10 ug/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 ug/mL is recommended for immunofluorescence. For radioimmunoassay (RIA), a working dilution of 1:10,000 is recommended. Sensitivity - 120 pg/sample; IC50-1 ng/ sample. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity Confirmed by RIA against the synthetic peptide.
Species Against Human
Antibody Against beta Endorphin
Cross-reactivity Human; mouse; rat. Beta-endorphin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%.
Blast it If you wish to use this product in a species other than those specified here and want to determine the amino acid sequence homology between the immunogen and the corresponding protein in that species, simply copy the amino acid sequence for this immunogen and test it on the BLAST database that you can access through the link below. Please note that antibodies raised against synthetic peptides are quite often very specific for that peptide. What this means in practise is that a single amino acid difference may be enough to restrict the specificity to a particular molecule. The BLAST database can also be used to compare any amino acid sequence between species and between proteins. The full amino acid sequence of the target protein can be found by following the link in the Accession field. You can then search any amino acid sequence in the target protein using the BLAST database. When selecting a sequence to search, please choose carefully, as the sequence you choose may be a precursor rather than the mature protein for example.
Blast URL Click here
Form Lyophilised with BSA
Appearance White powder
Reconstitution Reconstitute in 0.05 mL of PBS (pH 7.4). Centrifuge to remove any insoluble material.
Storage At least 12 months after purchase at 2-8C (lyophilized formulations). After reconstitution, aliquot and store at -20C for a higher stability and at 2-8C with an appropriate antibacterial agent. Avoid freeze-thaw cycles
Expiry Date 12 months after purchase
Images (click to zoom)
Rabbit polyclonal antibody to human beta Endorphin (1-31) Immunohistochemical staining in rat ventral periaqueductal grey matter (PAG). 4% paraformaldehyde fixed rat brain crystostat sections (10 µm) were incubated overnight at 4°C with Rabbit polyclonal antibody to human beta Endorphin (10 µg/ml) followed by incubation with FITC conjugated secondary antibody.

PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

MSDS

Click to download the MSDS - Click to download the MSDS

Offices in the USA and Australia
My Ice Bucket  
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_ID
Click to make a payment


Official PayPal Seal