biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides An Australia-US partnershipPhone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
HomeAbout BiosensisBiosensis distributorsResourcesHelp deskordering from BiosensisContact us
 


Technical Notes
 
View our tech notes
 
 
Follow us...
 
Google+ Follow us on Twitter

Find us on Facebook

Sign up for Biosensis newsletters
Visit our newsletter archive
 
 

Recombinant Human CNTF

$237.00USD


Catalogue No. PE-003-100
Description CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Batch No. See product label
Unit size 100 g
Sequence Histidine-V5 epitope fused to human CNTF (aa: 15-200) MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPTLDLCSRSIWLARKIRSDLTALTESYVKH QGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDF HQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTV RSIHDLRFISSHQTGIPARGSHYIANNKKM
Other Names Ciliary NeuroTrophic Factor
Accession CNTF_HUMAN
Produced in E. coli
Molecular Weight 22.8 kDa
Purity 95% by SDS-PAGE
Biol. activity Increased survival promoting activity on neurons
Form Lyophilised
Reconstitution Reconstitute the freeze-dried CNTF protein in the buffer of choice, for example PBS.
Storage Keep lyophilized protein at 2-8C. Aliquot and keep at -20C for long-term storage. For short term keep at 4C. Avoid repetitive freeze/thaw cycles.
Specific References Qiping D et al. (2018) Mechanism and consequence of abnormal calcium homeostasis in Rett syndrome astrocytes. eLife. [Accepted Manuscript].

Williams EC et al. (2014) Mutant astrocytes differentiated from Rett syndrome patients-specific iPSCs have adverse effects on wild-type neurons. Hum Mol Genet. 2014 Jun 1;23(11):2968-80.
General References Lin, L. F. et al (1989) Science 246, 1023-5
Stockli, K. A. et al (1991) J Cell Biol 115, 447-59
Saggio, I. et al (1995) Embo J 14, 3045-54
Hermann, D. M. et al (2001) Neurobiol Dis 8, 655-66
Thier, M. et al (1995) J Neurosci Res 40, 826-35
Images (click to zoom)
Recombinant Human CNTF Non-reducing SDS-PAGE (12%) on the expressed hCNTF

PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

MSDS

Click to download the MSDS - Click to download the MSDS

Offices in the USA and Australia
My Ice Bucket  
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_ID
Click to make a payment


Official PayPal Seal