Recombinant Human CNTF

Products

Receptor Body Chimeras

Control Peptides and Antibodies

Quick Find

E-Newsletter

Sign up for biosensis Product Features

Home » Catalog » Proteins » PE-003-100

Recombinant Human CNTF

$217.00USD

Catalogue No.:	PE-003-100
Batch No.:	See product label
Unit size:	100 µg
Sequence:	Histidine-V5 epitope fused to human CNTF (aa: 15-200) MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPTLDLCSRSIWLARKIRSDLTALTESYVKH QGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDF HQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTV RSIHDLRFISSHQTGIPARGSHYIANNKKM
Other Names:	Ciliary NeuroTrophic Factor
Accession:	CNTF_HUMAN
Produced in:	E. coli
Description:	CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
MW:	22.8 kDa
Purity:	95% by SDS-PAGE
Biol. activity:	Increased survival promoting activity on neurons
Form:	Lyophilised
Reconstitution:	Reconstitute the freeze-dried CNTF protein in the buffer of choice, for example PBS.
Storage:	Aliquot and keep at -20°C for long-term storage. For short term keep at 4°C. Avoid repetitive freeze/thaw cycles.
References:	1. Lin, L. F. et al (1989) Science 246, 1023-5 2. Stockli, K. A. et al (1991) J Cell Biol 115, 447-59 3. Saggio, I. et al (1995) Embo J 14, 3045-54 4. Hermann, D. M. et al (2001) Neurobiol Dis 8, 655-66 5. Thier, M. et al (1995) J Neurosci Res 40, 826-35

Images (click to zoom)

Recombinant Human CNTF

Non-reducing SDS-PAGE (12%) on the expressed hCNTF

PDF Data Sheet	- Click to download the Data Sheet
MSDS	- Click to download the Material Safety Data Sheet

My Ice Bucket

Click to visit My Ice Bucket

0 items

Currencies

Email This Page

Notifications

Click to visit Notifications

Notify me of updates to Recombinant Human CNTF

We Accept PayPal

Click to make a payment

Reviews

Click to visit Reviews

Write a review on this product!