Agouti related protein (AGRP), Guinea pig Polyclonal Antibody

Product Info

Product Name Agouti related protein (AGRP), Guinea pig Polyclonal Antibody
Product Description google Guinea Pig anti-Agouti related protein (AGRP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Alternative Names Agrp; Agrt; Art; Agouti-related protein;
Application(s) IHC-Frozen
Antibody Host Guinea Pig
Antibody Type Polyclonal
Specificity Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
Species Reactivity Human, Mouse, Rat, Sheep
Immunogen Description A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Conjugate Unconjugated
Purity Description Neat serum
Regulatory Status For research use only.

Specifications

Product Description Guinea Pig anti-Agouti related protein (AGRP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Application(s) IHC-Frozen
Application Details IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/mL of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Target Agouti related protein (AGRP)
Specificity Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
Target Host Species Mouse
Species Reactivity Human, Mouse, Rat, Sheep
Antibody Host Guinea Pig
Antibody Type Polyclonal
Antibody Isotype Mixed
Conjugate Unconjugated
Immunogen Description A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Purity Description Neat serum
Format Lyophilized
Reconstitution Instructions Spin vial briefly before opening. Reconstitute in 50 µL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material.
Storage Instructions Store lyophilized antibody at 2-8ºC. It is recommended that a thawed sample is stored at 2-8°C for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20°C or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
Batch Number Please see item label.
Expiration Date 12 months after date of receipt (unopened vial).
Alternative Names Agrp; Agrt; Art; Agouti-related protein;
Uniprot Number P56473
Uniprot Number/Name P56473 (AGRP_MOUSE)
Scientific Background AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
Shipping Temperature 25°C (ambient)
UNSPSC CODE 41116161
Regulatory Status For research use only.

Images, Protocols & SDS

The 4% PFA fixed, frozen cryostat section of the sheep hypothalamus was incubated in guinea pig polyclonal antibodies to the mouse AGRP protein at the dilution of 1:1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.
Immunohistochemical detection of AGRP in the arcuate nucleus of rat brain using Guinea pig polyclonal antibody to mouse agouti related protein (GP-029-50) incubated at the dilution of 1:1000-2000 in PBS overnight followed by incubation with Alexa-568 goat anti-guinea pig (1:500) secondary antibody. Section is 4% PFA fixed, frozen, cyrosectioned material. In rodents nerve terminals are more often identified than whole cell bodies using GP-029-50

Immunohistochemical detection of agouti-related protein (AGRP) synthesizing neurons in the human infundibular nucleus using the GP-029-50 primary antibody (1:50 000), followed by its visualization with the biotinylated secondary antibody-ABC method and nickel-diaminobenzidine chromogen. Photo courtesy of Dr. Erik Hrabovszky, Hungarian Academy of Sciences, Budapest, Hungary.

Immunohistochemical detection of agouti-related protein (AGRP) synthesizing neurons in the arcuate nucleus of the rat using the GP-029-50 primary antiserum (1:50 000), followed by its visualization with the biotinylated secondary antibody-ABC method and nickel-diaminobenzidine chromogen. Photo courtesy of Dr. Erik Hrabovszky, Hungarian Academy of Sciences, Budapest, Hungary.

Citations & References

General References Skrapits K et al (2014) Colocalization of cocaine- and amphetamine-regulated transcript with kisspeptin and neurokinin B in the human infundibular region. PLoS One 9:(8):e103977.PMID: 25084101 Application:IH, 4% PFA, frozen sections; 1:1000, 48 hr; Cy5 Fluorescent detection with antigen recovery.

Grayson BE, Allen SE, Billes SK, Williams SM, Smith MS, Grove KL (2006). Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate. Neurosci 143 pp. 975-986.