biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides An Australia-US partnershipPhone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
HomeAbout BiosensisBiosensis distributorsResourcesHelp deskordering from BiosensisContact usFlyers
 


Technical Notes
 
View our tech notes
 
 
Follow us...
 
Google+ Follow us on Twitter

Find us on Facebook

Sign up for Biosensis newsletters
Visit our newsletter archive
 
 

Mouse monoclonal antibody to human Noelin/Olfactomedin 1 [2G12-1B3]: IgG

$327.00USD


Catalogue No. M-887-100
Description Human Noelin/olfactomedin 1 shares high sequence homology with the rat protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. It localises to the endoplasmic reticulum lumen and there are several isoforms produced by alternative splicing. Also, it may play an important role in regulating the production of neural crest cells by the neural tube. Protein is secreted and glycosylated at multiple sites; Noelin is peripherally associated with the AMPAR complex, the AMPA receptor needed for fast synaptic transmission, and thus Noelin may play a role in synaptic function as well; Noelin has 5 isoforms produced by alternative splicing; isoform is the longest
Batch No. See product label
Unit size 100 ug
Antigen Full recombinant human Noelin/olfactomedin 1 protein with a GST tag
Sequence MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD
Antibody Type IgG1
Isotype IgG1 kappa
Clone 2G12-1B3
Other Names Neuronal olfactomedin-related ER localized protein, OLFM1, NOE1, NOEL1
Accession Q99784- NOE1_HUMAN
Produced in Mouse
Purity Protein G purified immunoglobulin
Applications This antibody is recommended for ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity Specificity has been confirmed by direct ELISA against the antigen.
Cross-reactivity Human. Other species have not been tested.
Blast it To see the shared identity between different species or other proteins, follow the link in the Accession field, select the sequence that you are interested in and copy and paste it HERE and blast/format it.
Form Lyophilised from PBS pH 7.2
Reconstitution Reconstitute in 100 uL of sterile water. Centrifuge to remove any insoluble material.
Storage After reconstitution keep aliquots at -20C for higher stability or at 2-8C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Expiry Date 12 months after purchase
PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

MSDS

Click to download the MSDS - Click to download the MSDS

Offices in the USA and Australia
My Ice Bucket  
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_ID
Click to make a payment


Official PayPal Seal