Catalogue No. |
PE-1839-100 |
Description |
The nucleocapsid protein (N-protein) is a structural protein that binds to the coronavirus RNA genome, thus creating a shell (or capsid) around the enclosed nucleic acid. The N-protein also 1) interacts with the viral membrane protein during viral assembly, 2) assists in RNA synthesis and folding, 3) plays a role in virus budding, and 4) affects host cell responses, including cell cycle and translation. Biosensis SARS-CoV-2 Nucleocapsid protein (NP) protein is an E. coli expressed, recombinant protein fragment designed for research scientific study of the SARS-CoV-2 virus and the COVID-19 disease it causes. |
Related products |
SARS-CoV-2 Nucleocapsid Protein (NP) IgG ELISA Kit
SARS-CoV-2 Nucleocapsid Protein (NP) IgM ELISA Kit
SARS-CoV-2 Nucleocapsid Protein (NP) Total Antibody ELISA Kit
SARS-CoV-2 S1 Receptor-Binding Domain (S1RBD) IgG ELISA Kit
SARS-CoV-2 Spike Protein S1 Receptor-Binding Domain (S1RBD) Protein |
Batch No. |
See product label |
Unit size |
100 ug |
Sequence |
SDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTAS WFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKM KDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNP ANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSRNSTPGSSR GTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAE ASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQI AQFAPSASAFFGMSRIGMEVTPSGTWLTYTAAIKLDDKDPNFKDQVILLNK HIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSK QLQQSMSSADSTQA |
Other Names |
Nucleocapsid phosphoprotein [Severe acute respiratory syndrome coronavirus 2] |
Accession |
GenBank: QIV14980.1 |
Produced in |
E.coli. A DNA sequence encoding 418 amino acids (tag-free) was expressed and purified from E.coli. |
Molecular Weight |
45.5 kDa (calculated) |
Purity |
>95%, as determined by SDS-PAGE |
Biol. activity |
Determined by one-site ELISA. Reactivity to human serum from COVID-19+ patients diluted up to 1:70,000. |
Form |
Liquid at 1.0 mg/mL, in 50 mM Tris, 300 mM NaCl, 10% Glycerol, pH 8.0, no preservatives. Aliquot into usable portions upon arrival using sterile techniques. Avoid freeze-thaw cycles. |
Storage |
Product ships on ice packs and is stable from ambient to refrigerated temperatures for 1 week. For storage, divide into useable aliquots and store at -80C.
NP shows strong self-interaction which leads to precipitation easily. NP protein with concentration less than 2 mg/mL is stable at 2-8C for >1 week. However, storage as liquid at cool temperatures can induce crystallization of the protein. This crystallization is reversible and will do no harm the NP protein (including antigenicity and concentration) and will disappear after equilibration to room temperature or >16C. |
Expiry Date |
3 months from date of receipt (unopened and frozen at -80C). 1 month opened, any temperature. |
MSDS |
Biosensis PE-1839-100_MSDS_5-2020.pdf
|