biosensis fine bioscience tools - antibodies, elisa kits, proteins, toxins and peptides An Australia-US partnershipPhone: 1800 605 5127 in the US, or +61 8 8352 7711 for international enquiries to Australia.
HomeAbout BiosensisBiosensis distributorsResourcesHelp deskordering from BiosensisContact usFlyers
 


Technical Notes
 
View our tech notes
 
 
Follow us...
 
Google+ Follow us on Twitter

Find us on Facebook

Sign up for Biosensis newsletters
Visit our newsletter archive
 
 

SARS-CoV-2 Nucleocapsid Protein (NP)

$397.00USD


Catalogue No. PE-1839-100
Description The nucleocapsid protein (N-protein) is a structural protein that binds to the coronavirus RNA genome, thus creating a shell (or capsid) around the enclosed nucleic acid. The N-protein also 1) interacts with the viral membrane protein during viral assembly, 2) assists in RNA synthesis and folding, 3) plays a role in virus budding, and 4) affects host cell responses, including cell cycle and translation. Biosensis SARS-CoV-2 Nucleocapsid protein (NP) protein is an E. coli expressed, recombinant protein fragment designed for research scientific study of the SARS-CoV-2 virus and the COVID-19 disease it causes.
Related products SARS-CoV-2 Nucleocapsid Protein (NP) IgG ELISA Kit
SARS-CoV-2 Nucleocapsid Protein (NP) IgM ELISA Kit
SARS-CoV-2 Nucleocapsid Protein (NP) Total Antibody ELISA Kit
SARS-CoV-2 S1 Receptor-Binding Domain (S1RBD) IgG ELISA Kit
SARS-CoV-2 Spike Protein S1 Receptor-Binding Domain (S1RBD) Protein
Batch No. See product label
Unit size 100 ug
Sequence SDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTAS WFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKM KDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNP ANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSRNSTPGSSR GTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAE ASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQI AQFAPSASAFFGMSRIGMEVTPSGTWLTYTAAIKLDDKDPNFKDQVILLNK HIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSK QLQQSMSSADSTQA
Other Names Nucleocapsid phosphoprotein [Severe acute respiratory syndrome coronavirus 2]
Accession GenBank: QIV14980.1
Produced in E.coli. A DNA sequence encoding 418 amino acids (tag-free) was expressed and purified from E.coli.
Molecular Weight 45.5 kDa (calculated)
Purity >95%, as determined by SDS-PAGE
Biol. activity Determined by one-site ELISA. Reactivity to human serum from COVID-19+ patients diluted up to 1:70,000.
Form Liquid at 1.0 mg/mL, in 50 mM Tris, 300 mM NaCl, 10% Glycerol, pH 8.0, no preservatives. Aliquot into usable portions upon arrival using sterile techniques. Avoid freeze-thaw cycles.
Storage Product ships on ice packs and is stable from ambient to refrigerated temperatures for 1 week. For storage, divide into useable aliquots and store at -80C.

NP shows strong self-interaction which leads to precipitation easily. NP protein with concentration less than 2 mg/mL is stable at 2-8C for >1 week. However, storage as liquid at cool temperatures can induce crystallization of the protein. This crystallization is reversible and will do no harm the NP protein (including antigenicity and concentration) and will disappear after equilibration to room temperature or >16C.
Expiry Date 3 months from date of receipt (unopened and frozen at -80C). 1 month opened, any temperature.
MSDS Click to download the Material Safety Data SheetBiosensis PE-1839-100_MSDS_5-2020.pdf
Images (click to zoom)
SARS-CoV-2 Nucleocapsid Protein (NP) Purity analysis by SDS-PAGE.

PDF Data Sheet

Click to download the data sheet - Click to download the Data Sheet

Offices in the USA and Australia
My Ice Bucket  
 
0 items
 
 
Currencies
 
  
 
 
Email This Page
 
 
Tell someone you know about this product.
 
 
We Accept PayPal
 
You can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_IDYou can use secured services of paypal to send us money via our email account MODULE_PAYMENT_PAYPAL_IPN_ID
Click to make a payment


Official PayPal Seal