Neuronal nuclei antigen [NeuN]/FOX3, (NeuN/FOX3), Chicken Polyclonal Antibody

As low as US$317.00
Only %1 left
Catalog Number
C-2127

    Product Info

  • Product Name Neuronal nuclei antigen [NeuN]/FOX3, (NeuN/FOX3), Chicken Polyclonal Antibody
  • Product Description google Chicken anti-Neuronal nuclei antigen [NeuN] /RNA binding protein fox-1 homolog 3 [FOX3], (NeuN/FOX3), Polyclonal Antibody (Unconjugated), suitable for WB and Immunostaining.
  • Alternative Names Neuronal nuclei antigen, NeuN, NA binding protein fox-1 homolog 3, Fox3, NeuN, A6NFN3, RBFOX3, Fox-1 homolog C
  • Application(s) IF, ICC, IHC, WB
  • Antibody Host Chicken
  • Antibody Type Polyclonal
  • Specificity Species cross-reactivity includes human, rat, and mouse.
  • Species Reactivity Human, Mouse, Rat
  • Immunogen Description The antibody has been made against a recombinant construct, based on the N-terminal (100 amino acids) of human FOX3 expressed in and purified from E Coli.
  • Conjugate Unconjugated
  • Purity Description IgY Preparation
  • Regulatory Status For research use only.

    Specifications

  • Product Description Chicken anti-Neuronal nuclei antigen [NeuN] /RNA binding protein fox-1 homolog 3 [FOX3], (NeuN/FOX3), Polyclonal Antibody (Unconjugated), suitable for WB and Immunostaining.
  • Related Products Neuronal nuclei antigen [NeuN]/FOX3, (NeuN/FOX3), Mouse Monoclonal Antibody (1B7)
    Neuronal nuclei antigen [NeuN]/FOX3, (NeuN/FOX3), Rabbit Polyclonal Antibody
  • Application(s) IF, ICC, IHC, WB
  • Application Details Western blot (WB), Immunocytochemistry (ICC) / Immunofluorescence (IF), Immunohistochemistry (IHC). A dilution of 1:500 - 1:1,000 is recommended for WB. A dilution of 1:5,000 – 1:10,000 is recommended for ICC/IF and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
  • Target Neuronal nuclei antigen [NeuN] / RNA binding protein fox-1 homolog 3 [FOX3] (NeuN/FOX3)
  • Specificity Species cross-reactivity includes human, rat, and mouse.
  • Target Host Species Human
  • Species Reactivity Human, Mouse, Rat
  • Antibody Host Chicken
  • Antibody Type Polyclonal
  • Antibody Isotype IgY
  • Conjugate Unconjugated
  • Immunogen Description The antibody has been made against a recombinant construct, based on the N-terminal (100 amino acids) of human FOX3 expressed in and purified from E Coli.
  • Sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
  • Purity Description IgY Preparation
  • Format Lyophilized IgY preparation, with sodium azide.
  • Reconstitution Instructions Spin vial briefly before opening. Reconstitute with 100 µL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material.
  • Storage Instructions Store lyophilized antibody at 2-8°C After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles. Store at 4°C for up to one month for short term storage and frequent use.
  • Batch Number Please see item label.
  • Expiration Date 12 months after date of receipt (unopened vial).
  • Alternative Names Neuronal nuclei antigen, NeuN, NA binding protein fox-1 homolog 3, Fox3, NeuN, A6NFN3, RBFOX3, Fox-1 homolog C
  • Uniprot Number A6NFN3
  • Uniprot Number/Name A6NFN3 (RFOX3_HUMAN)
  • Scientific Background FOX3 is one of a family of mammalian homologues of FOX1 (FOX is an acronym of "Feminizing locus on X”). The FOX proteins are about 46 kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on FOX3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/FOX3 functions as a Pre-mRNA alternative splicing regulator. It regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD) and is expressed heavily and specifically in neuronal nuclei and cytoplasm. In the cerebellum, Fox3 does not stain Purkinje neurons or Golgi neurons. The antibody was raised against the N-terminal (100 amino acids) of human FOX3, as expressed in and purified from E. coli. The full length FOX3 is not used as the immunogen since the three mammalian FOX homologues, namely FOX1, FOX2 and FOX3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules, so antibodies specific for each of the three molecules can therefore be generated.
  • Shipping Temperature 25°C (ambient)
  • UNSPSC CODE 41116161
  • Regulatory Status For research use only.

    Images, Protocols & SDS

  • Image of a rat hippocampus section by Immunofluorescence and Immunohistochemistry. The section was stained with C-2127-100, Neuronal nuclei antigen [NeuN] /RNA binding protein fox-1 homolog 3 [FOX3], (NeuN/FOX3), Chicken pAb, (red, 1:5,000), and co-stained with productR-1820-50, Ionized calcium-binding adapter molecule 1 (IBA1), Rabbit pAb, (1:2,000, green). Product C-2127-100 stains the nuclei and distal perikarya of most neurons, while product R-1820-50 labels microglial cells. IHC Method: Following transcardial perfusion with 4% paraformaldehyde, rat brain was post fixed for 24 hours, cut to 35µm, and free floating sections were stained.


  • Analysis by western blot of NeuN/FOX3 expression in mouse brain nuclear fraction with C-2127-100, Neuronal nuclei antigen [NeuN] /RNA binding protein fox-1 homolog 3 [FOX3], (NeuN/FOX3), Chicken pAb, (green, 1:1,000) with two bands at approx 46kDa and 50kDa corresponding to the two isoforms of NeuN/FOX3 protein. Lane 1: protein standard (red); Lane 2: mouse brain nuclear fraction.


    Image of formalin-fixed paraffin-embedded rat cerebellum section by Immunohistochemistry. The section was stained with C-2127-100, Neuronal nuclei antigen [NeuN] /RNA binding protein fox-1 homolog 3 [FOX3], (NeuN/FOX3), Chicken pAb, (brown, 1:10,000) and counter stained with Hematoxylin (blue). Product C-2127-100 stains the nuclei and distal perikaryal of most neurons.

    Citations & References