Guinea Pig anti-Agouti related protein (AGRP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Alternative NamesAgrp; Agrt; Art; Agouti-related protein;
Application(s)IHC-Frozen
Antibody HostGuinea Pig
Antibody TypePolyclonal
SpecificitySpecificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
Species ReactivityHuman, Mouse, Rat, Sheep
Immunogen DescriptionA synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Guinea Pig anti-Agouti related protein (AGRP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Application(s)IHC-Frozen
Application DetailsIHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/mL of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
TargetAgouti related protein (AGRP)
SpecificitySpecificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
Target Host SpeciesMouse
Species ReactivityHuman, Mouse, Rat, Sheep
Antibody HostGuinea Pig
Antibody TypePolyclonal
Antibody IsotypeMixed
ConjugateUnconjugated
Immunogen DescriptionA synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Purity DescriptionNeat serum
FormatLyophilized
Reconstitution InstructionsSpin vial briefly before opening. Reconstitute in 50 µL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material.
Storage InstructionsStore lyophilized antibody at 2-8ºC or lower. After reconstitution, divide into aliquots and store at -20°C, or lower, for optimal long term stability. It is recommended that a reconstituted aliquot is stored at 2-8°C for no longer than 2 weeks. Allocation of an appropriate anti-bacterial agent can increase shelf life by several weeks. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
Batch NumberPlease see item label.
Expiration Date
12 months after date of receipt (lyophilized, unopened vial).
Alternative NamesAgrp; Agrt; Art; Agouti-related protein;
Scientific BackgroundAGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
The 4% PFA fixed, frozen cryostat section of the sheep hypothalamus was incubated in guinea pig polyclonal antibodies to the mouse AGRP protein at the dilution of 1:1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.
Immunohistochemical detection of AGRP in the arcuate nucleus of rat brain using Guinea pig polyclonal antibody to mouse agouti related protein (GP-029-50) incubated at the dilution of 1:1000-2000 in PBS overnight followed by incubation with Alexa-568 goat anti-guinea pig (1:500) secondary antibody. Section is 4% PFA fixed, frozen, cyrosectioned material. In rodents nerve terminals are more often identified than whole cell bodies using GP-029-50
Immunohistochemical detection of agouti-related protein (AGRP) synthesizing neurons in the human infundibular nucleus using the GP-029-50 primary antibody (1:50 000), followed by its visualization with the biotinylated secondary antibody-ABC method and nickel-diaminobenzidine chromogen. Photo courtesy of Dr. Erik Hrabovszky, Hungarian Academy of Sciences, Budapest, Hungary.
Immunohistochemical detection of agouti-related protein (AGRP) synthesizing neurons in the arcuate nucleus of the rat using the GP-029-50 primary antiserum (1:50 000), followed by its visualization with the biotinylated secondary antibody-ABC method and nickel-diaminobenzidine chromogen. Photo courtesy of Dr. Erik Hrabovszky, Hungarian Academy of Sciences, Budapest, Hungary.
General ReferencesSkrapits K et al (2014) Colocalization of cocaine- and amphetamine-regulated transcript with kisspeptin and neurokinin B in the human infundibular region. PLoS One 9:(8):e103977.PMID: 25084101 Application:IH, 4% PFA, frozen sections; 1:1000, 48 hr; Cy5 Fluorescent detection with antigen recovery.
Grayson BE, Allen SE, Billes SK, Williams SM, Smith MS, Grove KL (2006). Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate. Neurosci 143 pp. 975-986.