SpecificityThe specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat;
Species ReactivityHuman, Rat
Immunogen DescriptionA synthetic peptide (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) corresponding to a region (24-58) from human integrin beta-2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
ConjugateUnconjugated
Purity DescriptionAffinity purified on antigen column
Application DetailsImmunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human integrin beta-2 has a predicted length of 769 amino acids and a MW of 85 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect Integrin beta-2 in formalin fixed and paraffin embedded tissues. Antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
TargetIntegrin beta-2
SpecificityThe specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat;
Target Host SpeciesHuman
Species ReactivityHuman, Rat
Antibody HostRabbit
Antibody TypePolyclonal
Antibody IsotypeIgG
ConjugateUnconjugated
Immunogen DescriptionA synthetic peptide (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) corresponding to a region (24-58) from human integrin beta-2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Purity DescriptionAffinity purified on antigen column
Reconstitution InstructionsSpin vial briefly before opening. Reconstitute in 100 µL sterile-filtered, ultrapure water to achieve an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage InstructionsAt least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Batch NumberPlease see item label.
Expiration Date12 months after date of receipt (unopened vial).
Scientific BackgroundIntegrins are cell-surface proteins with important roles in cell adhesion, migration and cell surface mediated signalling. The integrin family contains at least 18 alpha and 8 beta subunits that form alpha/beta heterodimers. The integrin beta-2 subunit is also known as CD18 or ITGB2. Integrin beta-2 associates with the alpha-L subunit to form the LFA1 integrin which is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It combines with the alpha-M subunit to form the Mac1 integrin. Integrin beta-2 also associates with the alpha-X and alpha-D subunits.