1800 605-5127
+61 (0)8 8352 7711
Beta Endorphin, Rabbit Polyclonal Antibody
As low as
US$327.00
Only %1 left
Catalog Number
R-1492
- Product Name Beta Endorphin, Rabbit Polyclonal Antibody
- Product Description Rabbit anti-Beta Endorphin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
- Alternative Names -endorphin; Pro-opiomelanocortin; POMC;
- Application(s) ICC, IHC-Frozen, IHC-Paraffin-embedded
- Antibody Host Rabbit
- Antibody Type Polyclonal
- Specificity Confirmed by RIA against the synthetic peptide. Human; mouse; rat. Beta-endorphin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%.
- Species Reactivity Human, Mouse, Rat
- Immunogen Description Synthetic human beta-endorphin peptide (1-31 aa) conjugated to BSA.
- Conjugate Unconjugated
- Purity Description Affinity-purified
- Regulatory Status For research use only.
Product Info
- Product Description Rabbit anti-Beta Endorphin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
- Application(s) ICC, IHC-Frozen, IHC-Paraffin-embedded
- Application Details A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. For radioimmunoassay (RIA), a working dilution of 1:10,000 is recommended. Sensitivity - 120 pg/sample; IC50-1 ng/ sample. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
- Target Beta Endorphin
- Specificity Confirmed by RIA against the synthetic peptide. Human; mouse; rat. Beta-endorphin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%.
- Target Host Species Human
- Species Reactivity Human, Mouse, Rat
- Antibody Host Rabbit
- Antibody Type Polyclonal
- Antibody Isotype IgG
- Conjugate Unconjugated
- Immunogen Description Synthetic human beta-endorphin peptide (1-31 aa) conjugated to BSA.
- Sequence YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
- Purity Description Affinity-purified
- Format Lyophilized with BSA
- Reconstitution Instructions Spin vial briefly before opening. Reconstitute in 0.05 mL of sterile-filtered PBS (pH 7.4). Centrifuge to remove any insoluble material.
- Storage Instructions At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
- Batch Number Please see item label.
- Expiration Date 12 months after date of receipt (unopened vial).
- Alternative Names -endorphin; Pro-opiomelanocortin; POMC;
- Uniprot Number P01189
- Uniprot Number/Name P01189 (COLI_HUMAN)
- Scientific Background Human beta-endorphin is a 31 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). It is an endogenous opioid peptide neurotransmitter that interacts with opioid receptors.
- Shipping Temperature 25°C (ambient)
- UNSPSC CODE 41116161
- Regulatory Status For research use only.
