1800 605-5127
+61 (0)8 8352 7711
Noelin/Olfactomedin 1, Mouse Monoclonal Antibody
As low as
US$417.00
Only %1 left
Catalog Number
M-887
- Product Name Noelin/Olfactomedin 1, Mouse Monoclonal Antibody
- Product Description Mouse anti-Noelin/Olfactomedin 1 Monoclonal Antibody (Unconjugated), suitable for ELISA.
- Alternative Names Neuronal olfactomedin-related ER localized protein, OLFM1, NOE1, NOEL1
- Application(s) ELISA
- Antibody Host Mouse
- Antibody Type Monoclonal
- Specificity Specificity has been confirmed by direct ELISA against the antigen. Human. Other species have not been tested.
- Species Reactivity Human
- Immunogen Description Full recombinant human Noelin/olfactomedin 1 protein with a GST tag
- Conjugate Unconjugated
- Purity Description Protein G purified immunoglobulin
- Regulatory Status For research use only.
Product Info
- Product Description Mouse anti-Noelin/Olfactomedin 1 Monoclonal Antibody (Unconjugated), suitable for ELISA.
- Application(s) ELISA
- Application Details This antibody is recommended for ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
- Target Noelin/Olfactomedin 1
- Specificity Specificity has been confirmed by direct ELISA against the antigen. Human. Other species have not been tested.
- Target Host Species Human
- Species Reactivity Human
- Antibody Host Mouse
- Antibody Type Monoclonal
- Antibody Isotype IgG1, kappa
- Clone Name 2G12-1B3
- Conjugate Unconjugated
- Immunogen Description Full recombinant human Noelin/olfactomedin 1 protein with a GST tag
- Sequence MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD
- Purity Description Protein G purified immunoglobulin
- Format Lyophilized from PBS pH 7.2
- Reconstitution Instructions Spin vial briefly before opening. Reconstitute in 100 µL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material.
- Storage Instructions After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
- Batch Number Please see item label.
- Expiration Date 12 months after date of receipt (unopened vial).
- Alternative Names Neuronal olfactomedin-related ER localized protein, OLFM1, NOE1, NOEL1
- Uniprot Number Q99784
- Uniprot Number/Name Q99784 (NOE1_HUMAN)
-
Scientific Background
Human Noelin/olfactomedin 1 shares high sequence homology with the rat protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. It localises to the endoplasmic reticulum lumen and there are several isoforms produced by alternative splicing. Also, it may play an important role in regulating the production of neural crest cells by the neural tube. Protein is secreted and glycosylated at multiple sites; Noelin is peripherally associated with the AMPAR complex, the AMPA receptor needed for fast synaptic transmission, and thus Noelin may play a role in synaptic function as well; Noelin has 5 isoforms produced by alternative splicing; isoform is the longest
- Shipping Temperature 25°C (ambient)
- UNSPSC CODE 41116161
- Regulatory Status For research use only.