Ciliary neurotrophic factor (CNTF), Purified Recombinant Protein

Product Info

Product Name Ciliary neurotrophic factor (CNTF), Purified Recombinant Protein
Product Description google Ciliary neurotrophic factor (CNTF), Purified Recombinant Protein, suitable for Cell Culture.
Alternative Names Ciliary NeuroTrophic Factor
Application(s) Cell Culture
Purity Description 95% by SDS-PAGE
Purity % > 95%
Regulatory Status For research use only.

Specifications

Product Description Ciliary neurotrophic factor (CNTF), Purified Recombinant Protein, suitable for Cell Culture.
Application(s) Cell Culture
Target Ciliary neurotrophic factor (CNTF)
Target Host Species Human
Antigen Produced In E. coli
Sequence Histidine-V5 epitope fused to human CNTF (aa: 15-200)MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPTLDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Purity Description 95% by SDS-PAGE
Purity % > 95%
Format Lyophilized
Reconstitution Instructions Reconstitute the freeze-dried CNTF protein in the buffer of choice, for example PBS.
Storage Instructions Aliquot and keep at -20°C for long-term storage. For short term keep at 2-8°C. Avoid repetitive freeze/thaw cycles.
Batch Number Please see item label.
Expiration Date 12 months after date of receipt (unopened vial).
Alternative Names Ciliary NeuroTrophic Factor
Uniprot Number P26441
Uniprot Number/Name P26441 (CNTF_HUMAN)
Scientific Background CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Shipping Temperature 25°C (ambient)
UNSPSC CODE 12352202
Regulatory Status For research use only.

Images, Protocols & SDS

Non-reducing SDS-PAGE (12%) on the expressed hCNTF

Citations & References

Specific References Qiping D et al. (2018) Mechanism and consequence of abnormal calcium homeostasis in Rett syndrome astrocytes. eLife. [Accepted Manuscript].

Williams EC et al. (2014) Mutant astrocytes differentiated from Rett syndrome patients-specific iPSCs have adverse effects on wild-type neurons. Hum Mol Genet. 2014 Jun 1;23(11):2968-80.
General References Lin, L. F. et al (1989) Science 246, 1023-5
Stockli, K. A. et al (1991) J Cell Biol 115, 447-59
Saggio, I. et al (1995) Embo J 14, 3045-54
Hermann, D. M. et al (2001) Neurobiol Dis 8, 655-66
Thier, M. et al (1995) J Neurosci Res 40, 826-35