1800 605-5127
+61 (0)8 8352 7711
SARS-CoV-2 Nucleocapsid Protein (NP), Purified Recombinant Protein
Only %1 left
Catalog Number
PE-1839
Discontinued
- Product Name SARS-CoV-2 Nucleocapsid Protein (NP), Purified Recombinant Protein
- Product Description SARS-CoV-2 Nucleocapsid Protein (NP), Purified Recombinant Protein, suitable for ELISA.
- Alternative Names Nucleocapsid phosphoprotein [Severe acute respiratory syndrome coronavirus 2]
- Application(s) ELISA
- Purity Description >95%, as determined by SDS-PAGE
- Purity % > 95%
- Regulatory Status For research use only.
Product Info
- Product Description SARS-CoV-2 Nucleocapsid Protein (NP), Purified Recombinant Protein, suitable for ELISA.
-
Related Products
SARS-CoV-2 Nucleocapsid protein (NP), Human IgM, ELISA assay
SARS-CoV-2 Nucleocapsid protein (NP), Total Human IgG, ELISA assay
SARS-CoV-2 Spike Protein S1 Receptor-Binding Domain (S1RBD), Purified Recombinant Protein
- Application(s) ELISA
- Application Details Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
- Target SARS-CoV-2 Nucleocapsid protein (NP)
- Target Host Species Virus
- Sequence SDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTAS WFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKM KDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNP ANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSRNSTPGSSR GTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAE ASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQI AQFAPSASAFFGMSRIGMEVTPSGTWLTYTAAIKLDDKDPNFKDQVILLNK HIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSK QLQQSMSSADSTQA
- Purity Description >95%, as determined by SDS-PAGE
- Purity % > 95%
- Format Liquid at 1.0 mg/mL, in 50 mM Tris, 300 mM NaCl, 10% Glycerol, pH 8.0, no preservatives. Aliquot into usable portions upon arrival using sterile techniques. Avoid freeze-thaw cycles.
-
Storage Instructions
Product ships on ice packs and is stable from ambient to refrigerated temperatures for 1 week. For storage, divide into useable aliquots and store at -80°C.
NP shows strong self-interaction which leads to precipitation easily. NP protein with concentration less than 2 mg/mL is stable at 2-8°C for >1 week. However, storage as liquid at cool temperatures can induce crystallization of the protein. This crystallization is reversible and will do no harm the NP protein (including antigenicity and concentration) and will disappear after equilibration to room temperature or >16C. - Batch Number Please see item label.
- Expiration Date 3 months from date of receipt (unopened and frozen at -80°C). 1 month opened, any temperature.
- Alternative Names Nucleocapsid phosphoprotein [Severe acute respiratory syndrome coronavirus 2]
- Uniprot Number P0DTC9
- Uniprot Number/Name P0DTC9 (NCAP_SARS2)
- Scientific Background The nucleocapsid protein (N-protein) is a structural protein that binds to the coronavirus RNA genome, thus creating a shell (or capsid) around the enclosed nucleic acid. The N-protein also 1) interacts with the viral membrane protein during viral assembly, 2) assists in RNA synthesis and folding, 3) plays a role in virus budding, and 4) affects host cell responses, including cell cycle and translation. Biosensis SARS-CoV-2 Nucleocapsid protein (NP) protein is an E. coli expressed, recombinant protein fragment designed for research scientific study of the SARS-CoV-2 virus and the COVID-19 disease it causes.
- Shipping Temperature 2-8°C (on cold packs)
- UNSPSC CODE 12352202
- Regulatory Status For research use only.
