Integrin beta-2, Rabbit Polyclonal Antibody

As low as US$427.00
Only %1 left
Catalog Number
R-1011

    Product Info

  • Product Name Integrin beta-2, Rabbit Polyclonal Antibody
  • Product Description google Rabbit anti-Integrin beta-2 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
  • Alternative Names ITGB2; CD18; MF17; ITB2;
  • Application(s) IHC-Frozen, IHC-Paraffin-embedded, WB
  • Antibody Host Rabbit
  • Antibody Type Polyclonal
  • Specificity The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat;
  • Species Reactivity Human, Rat
  • Immunogen Description A synthetic peptide (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) corresponding to a region (24-58) from human integrin beta-2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
  • Conjugate Unconjugated
  • Purity Description Affinity purified on antigen column
  • Regulatory Status For research use only.

    Specifications

  • Product Description Rabbit anti-Integrin beta-2 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
  • Application(s) IHC-Frozen, IHC-Paraffin-embedded, WB
  • Application Details Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human integrin beta-2 has a predicted length of 769 amino acids and a MW of 85 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect Integrin beta-2 in formalin fixed and paraffin embedded tissues. Antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
  • Target Integrin beta-2
  • Specificity The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat;
  • Target Host Species Human
  • Species Reactivity Human, Rat
  • Antibody Host Rabbit
  • Antibody Type Polyclonal
  • Antibody Isotype IgG
  • Conjugate Unconjugated
  • Immunogen Description A synthetic peptide (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) corresponding to a region (24-58) from human integrin beta-2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
  • Purity Description Affinity purified on antigen column
  • Format Lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg NaN3
  • Reconstitution Instructions Spin vial briefly before opening. Reconstitute in 100 µL sterile-filtered, ultrapure water to achieve an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
  • Storage Instructions At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
  • Batch Number Please see item label.
  • Expiration Date 12 months after date of receipt (unopened vial).
  • Alternative Names ITGB2; CD18; MF17; ITB2;
  • Uniprot Number P05107
  • Uniprot Number/Name P05107 (ITB2_HUMAN)
  • Scientific Background Integrins are cell-surface proteins with important roles in cell adhesion, migration and cell surface mediated signalling. The integrin family contains at least 18 alpha and 8 beta subunits that form alpha/beta heterodimers. The integrin beta-2 subunit is also known as CD18 or ITGB2. Integrin beta-2 associates with the alpha-L subunit to form the LFA1 integrin which is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It combines with the alpha-M subunit to form the Mac1 integrin. Integrin beta-2 also associates with the alpha-X and alpha-D subunits.
  • Shipping Temperature 25°C (ambient)
  • UNSPSC CODE 41116161
  • Regulatory Status For research use only.

    Images, Protocols & SDS

    Citations & References