1800 605-5127
+61 (0)8 8352 7711
Hypoxia-inducible factor-2 (HIF-2-alpha), Rabbit Polyclonal Antibody
Only %1 left
Catalog Number
R-1122
Discontinued
- Product Name Hypoxia-inducible factor-2 (HIF-2-alpha), Rabbit Polyclonal Antibody
- Product Description Rabbit anti-Hypoxia-inducible factor-2 (HIF-2-alpha) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
- Alternative Names Endothelial PAS domain-containing protein 1; EPAS-1; Hypoxia-inducible factor 2 alpha; HIF-2 alpha; HIF2 alpha; Epas1; Hif2a;
- Application(s) IHC-Frozen, IHC-Paraffin-embedded, WB
- Antibody Host Rabbit
- Antibody Type Polyclonal
- Specificity The specificity of this antibody has been confirmed by WB and IHC against the antigen. Rat
- Species Reactivity Rat
- Immunogen Description A synthetic peptide (YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD) corresponding to a region (202-240) from rat Hypoxia-inducible factor-2 alpha. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
- Conjugate Unconjugated
- Purity Description Affinity purified on antigen column
- Regulatory Status For research use only.
Product Info
- Product Description Rabbit anti-Hypoxia-inducible factor-2 (HIF-2-alpha) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
-
Related Products
Hypoxia-inducible factor-2 alpha (HIF-2-alpha), Rabbit Polyclonal Antibody
- Application(s) IHC-Frozen, IHC-Paraffin-embedded, WB
- Application Details Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Rat HIF-2 alpha has a predicted length of 874 residues and MW of 97 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
- Target Hypoxia-inducible factor-2 (HIF-2-alpha)
- Specificity The specificity of this antibody has been confirmed by WB and IHC against the antigen. Rat
- Target Host Species Rat
- Species Reactivity Rat
- Antibody Host Rabbit
- Antibody Type Polyclonal
- Antibody Isotype IgG
- Conjugate Unconjugated
- Immunogen Description A synthetic peptide (YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD) corresponding to a region (202-240) from rat Hypoxia-inducible factor-2 alpha. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
- Purity Description Affinity purified on antigen column
- Format Lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg NaN3
- Reconstitution Instructions Spin vial briefly before opening. Reconstitute in 100 µL sterile-filtered, ultrapure water to achieve an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
- Storage Instructions At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles
- Batch Number Please see item label.
- Expiration Date 12 months after date of receipt (unopened vial).
- Alternative Names Endothelial PAS domain-containing protein 1; EPAS-1; Hypoxia-inducible factor 2 alpha; HIF-2 alpha; HIF2 alpha; Epas1; Hif2a;
- Uniprot Number Q9JHS1
- Uniprot Number/Name Q9JHS1 (EPAS1_RAT)
- Scientific Background Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the induction of oxygen regulated genes. HIF-2 alpha binds to a specific core DNA sequence within the hypoxia response element of target gene promoters.
- Shipping Temperature 25°C (ambient)
- UNSPSC CODE 41116161
- Regulatory Status For research use only.